Recombinant Hepatitis B Surface Antigen preS2 [PRP-874HBS]

SKU: PRP-874HBS Categories: ,
Clear

Source: E.coli.
Amino Acid Sequence: MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASP ISSIFSRTGDPAPN.