Recombinant Human Granulysin [PRP-852PRO]

SKU: PRP-852PRO Category: Product Size: 2 ug, 10 ug, 1 mg |
Clear

Source: Escherichia Coli.
Amino Acid Sequence: MGSSHHHHHHSSGLVPRGSHMMEGLVFSRLSPEYYDLARAHLRDEEKSCPCLAQEGPQGDLLTKTQELGRDYRTCLTIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQGLVAGETAQQICEDLRLCIPSTGPLGSHHHHHH.
Synonyms: LAG2, Lymphokine LAG-2, TLA519, NKG5, LAG2, D2S69E, Granulysin, T-cell activation protein 519, GNLY, D2S69E.