Syndecan-4 Human Recombinant, His tag [PRP-583]

SKU: PRP-583 Categories: , Product Size: 10 ug, 50 ug, 1 mg | Host: E. coli | Conjugate: His-tag |
Clear

Description

Syndecan-4 is a type I integral membrane heparan sulfate proteoglycan (HSPG), which was originally isolated from cloned rat microvascular endothelial cells as an antithrombin-binding molecule, and is now known to be a member of the syndecan family. Syndecan-4 binds to basic fibroblast growth factor (bFGF), midkine, and tissue factor pathway inhibitor via its heparan sulfate chains, and is thought to be involved in various biologic functions such as signaling of bFGF, anticoagulation, and focal adhesion formation. A previous study demonstrated that syndecan-4 is expressed in various tissues, and its level of expression in the kidney is stronger than those of other syndecan family members. Thus, syndecan-4 is thought to play certain roles in maintaining renal function. Moreover, it has been reported that proteoglycans, especially sulfated proteoglycans, are involved in organogenesis of the kidney.

Syndecan-4 Human Recombinant fused with 6X His tag produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 140 amino acids and having a molecular mass of 15.4 kDa. The SYND-4 is purified by proprietary chromatographic techniques. Purity is >95.0% as determined by RP-HPLC and SDS-PAGE. The SYND4 (1 mg/ml) was lyophilized after extensive dialyses against 20 mM PBS pH-7.4. The amino acid sequence is: MASIRETEVIDPQDLLEGRYFSGALPDDEDVVGPGQESDDFELSGSGDLDDLEDSMIGPEVVHPLVPLDNHIPERAGSGSQVPTEPKKLEENEVIPKRISPVEESEDVSNKVSMSSTVQGSNIFERTEVLALEHHHHHH

To view protocol(s) for this and other products please visit: www.ATSbio.com/support/protocols

View Data Sheet