Recombinant Human Myelin Oligodendrocyte Glycoprotein [PRP-466PRO]

SKU: PRP-466PRO Category: Product Size: 10 ug, 50 ug, 1 mg |
Clear

Source: Escherichia Coli.
Amino Acid Sequence: MGQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPGHHHHHH.
Synonyms: Myelin Oligodendrocyte Glycoprotein, MOG, MOGIG-2, MGC26137.