Recombinant Human Myelin Oligodendrocyte Glycoprotein [PRP-466PRO]

SKU: PRP-466PRO Category:
Clear

Source: Escherichia Coli.
Amino Acid Sequence: MGQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPGHHHHHH.
Synonyms: Myelin Oligodendrocyte Glycoprotein, MOG, MOGIG-2, MGC26137.