Recombinant Helicobacter Pylori Outer Membrane Protein [PRP-369PRO]

SKU: PRP-369PRO Category: Product Size: 100 ug, 1 mg, 500 ug |
Clear

Source: E.Coli
Amino Acid Sequence: MLVTKLAPDFKAPAVLGNNEVDEHFELSKNLGKNGAILFFWPKDFTFVCPTEIIAFDKRVKDFQEKGFNVIGVSIDSEQVHFAWKNTPVEKGGIGQVTFPMVADITKSISRDYDVLFEEAIALRGAFLIDKNMKVRHAVINDLPLGRNADEMLRMVDALLHFEEHGEVCPAGWRKGDKGMKATHQGVAEYLKENSIKL.