B-type Natriuretic Peptide Human [PRP-369CYT]

SKU: PRP-369CYT Categories: , Product Size: 10 mg, 25 mg, 100 mg | Host: synthetic peptide |
Clear

Natriuretic Peptide Precursor B acts as a cardiac hormone with a variety of biological actions including natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. It is thought to play a key role in cardiovascular homeostasis. It also helps restore the body’s salt and water balance and improves heart function.

B-type Natriuretic Peptide (BNP) human is a polypeptide chain containing 32 amino acids and having a molecular mass of 3464 Dalton. The protein was lyophilized without additives. Purity is greater than 98.0% as determined by RP-HPLC and SDS-PAGE.

Amino acid sequence: SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH-OH.

View Data Sheet