Recombinant Hepatitis B Virus e-Antigen [PRP-272HBV]

SKU: PRP-272HBV Categories: , Product Size: 5 ug, 25 ug, 1 mg |
Clear

Source: Escherichia Coli.
Amino Acid Sequence: MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNL EDPASRDLVVNYVNTNVGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVV
Applications: Immunoassay.