Follicle Stimulating Hormone Human Recombinant [PRP-253HOR]

SKU: PRP-253HOR Categories: , Host: HEK293 |
Clear

Follicle stimulating hormone (FSH) is a hormone synthesized and secreted by gonadotropes in the anterior pituitary gland. FSH and LH act synergistically in reproduction. In the ovary, FSH stimulates the growth of immature Graafian follicles to maturation. As the follicle grows it releases inhibin, which shuts off the FSH production. In men, FSH enhances the production of androgen-binding protein by the Sertoli cells of the testes and is critical for spermatogenesis. In both males and females, FSH stimulates the maturation of germ cells. In females, FSH initiates follicular growth, specifically affecting granulosa cells.

Follicle stimulating hormone (FSH) Human Recombinant produced in HEK-293 cells is a heterodimeric, glycosylated, polypeptide chain transfected with two expression plasmids encoding the human FSH alpha chain (Accession # P01215) (Met1-Ser116) and human FSH beta chain (Accession # P01225) (Met1-Glu129) having a total MW of 38 kDa. FSH human recombinant is purified by proprietary chromatographic techniques. It was lyophilized without additives. Purity is greater than 95% as determined by SDS-PAGE.

FSH subunit alpha: APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLR SKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS. FSH subunit beta: NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDP ARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTD CTVRGLGPSYCSFGEMKE

To view protocol(s) for this and other products please visit: www.ATSbio.com/support/protocols

View Data Sheet