Recombinant Herpes Simplex Virus-2 gBåÊ [PRP-226HSV]

SKU: PRP-226HSV Categories: , Product Size: 100 ug, 1 mg, 500 ug |
Clear

Source: Escherichia Coli.
Amino Acid Sequence: MIAPYKFKATMYYKDVTVSQVWFGHRYSQFMGIFEDRAPVPFEEVIDKINAKGVCRST AKYVRNNLETTAFHRDDHETDMELKPANAATRTSRGWHTTDLKYNPSRVEAFHRYGTTVNCIVEEVDARSVYPYDEFVLATGDFVYMSPFYGYREGSHTEHTSYAADRFKQVDGFYARDLTTKARATAPTTRNLLTTPKFTVAWDWVPKRPSVCTHHHHHH.
Applications: ELISA, WB, Flow-Through.