Recombinant HIV Type-O gp41 13kDa [PRP-007HIV]

SKU: PRP-007HIV Categories: ,
Clear

Source: Escherichia Coli.
Amino Acid Sequence: MGHHHHHHGSVQTHTLLKGIVQQQDNLLRAIQAQQHLLRLSVWGIRQLRARLLALETLI QNQQLLNLWGAKGRLIAYTSVKWNTTWGGGGSIWGNLTWQEWDQQIDNVSSIIYEEIQ  KAQDQQEQNEKKLLELDE.