Dengue Virus Envelope ST1 Recombinant [PRP-005DEN]

SKU: PRP-005DEN Categories: , Host: E. coli |
Clear

Dengue virus is caused by one of four closely related virus serotypes of the genus Flavivirus, family Flaviviridae. Each serotype is sufficiently different from the other such that there is no cross-protection and epidemics caused by multiple serotypes (hyperendemicity) can occur. In cell culture experiments and in mice Morpholino antisense oligos have shown specific activity against dengue virus.

The E. coli-derived recombinant 23 kDa protein is a genetically engineered peptide corresponding to dengue type-1 N-terminus envelope immunodeterminant regions. This region also contains a common antigen for dengue virus types 1, 2 and 3. The protein is purified by proprietary chromatographic technique. Purity is >95% as determined by PAGE followed by coomassie staining.

Sequence:

TEAKQPATLRKYCIEAKLTNTTTDSRCPTQGEPSLNEEQDKRFVCKHSMVDRGWGNGC

GLFGKGGIVTCAMFTCKKNMKGKVVQPENLEYTIVITPHSGEEHAVGNDTGKHGKEIKI

TPQSSITEAELTGYGTVTMECSPRTGLDFNEMVLLQMENKAWLVHRQWFLDLPLPWLP

GADTQGSNWIQKETLVTFKNPHAKKQDVVVLGSQEGAMHTALTGATEIQMSSGNLLFT

GHLKCRLRMDKLQLKG

To view protocol(s) for this and other products please visit: www.ATSbio.com/support/protocols

View Data Sheet