Recombinant West Nile Pre-M Virus [PRP-002WNV]

SKU: PRP-002WNV Categories: ,
Clear

Source: Escherichia Coli.
Amino Acid Sequence: MVTLSNFQGKVMMTVNATDVTDVITIPTAAGKNLCIVRA MDVGYLCEDTITYECPVLAAGNDPEDIDCWCTKSSVYVRYGRCTKTRHSRRSRRSLTVQTHGESTLANKKGAWLDSTKATRYLVKTESWILRNPGYALE.
Applications: Antigen in ELISA and Western blots, excellent antigen for detection of West-Nile virus with minimal specificity problems.