Recombinant Hantavirus [PRP-001HTV]

SKU: PRP-001HTV Categories: ,
Clear

Source: E.Coli
Amino Acid Sequence: GSMATMEELQREINAHEGQLVIARQKVRDAEKQYEKDPDELNKRTLTDRE GVAVSIQAKIDELKRQLADRIATGKNLGKEQDPTGVEPGDHLKERSMLSY GNVLDLNHLDIDEPTGQTADWLSIVVYVD
Applications: Immunoassay.
Synonyms: HTNV, Hantaan Virus, Hantanvirus.